PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27372.5 Da    PI: 10.1176
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001840genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-261059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +++fsstgkly+++s
  DCAR_001840 10 RIDNNTSRQVTFSKRRNGLLKKAKELAILCDAEVGLMVFSSTGKLYDFAS 59
                 8***********************************************86 PP

2K-box75.12e-2581170998
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  + +++ e +q e+++L+++++ Lq+++R+llGe+L  L++++L++Le++L  slk +R +K++ll+++i+el kk   +++en +L+kk+
  DCAR_001840  81 NPTSEVEFWQGEVERLRQQLQYLQQNHRQLLGEELFGLNINDLHNLENRLVISLKGVRMQKEQLLKDEIQELNKKGSLIHRENIELHKKV 170
                  467889**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-32289IPR002100Transcription factor, MADS-box
CDDcd002652.42E-43271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-283859IPR002100Transcription factor, MADS-box
PfamPF014868.3E-2483170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.34386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKIVIRR IDNNTSRQVT FSKRRNGLLK KAKELAILCD AEVGLMVFSS TGKLYDFAST  60
SMKSIIERYN KMKEENYQLL NPTSEVEFWQ GEVERLRQQL QYLQQNHRQL LGEELFGLNI  120
NDLHNLENRL VISLKGVRMQ KEQLLKDEIQ ELNKKGSLIH RENIELHKKV TLIQEANQEL  180
RKKVNGLASS STHIRNQTPF GISNGYDLNA SISLQLIQPM TKTNPTPETD VTLGLKLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D4e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-19274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S4e-19174174Myocyte-specific enhancer factor 2B
1tqe_R4e-19174174Myocyte-specific enhancer factor 2B
1tqe_Q4e-19174174Myocyte-specific enhancer factor 2B
1tqe_P4e-19174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480080.11e-111PREDICTED: MADS-box transcription factor 23-like isoform X2
SwissprotQ6EP498e-91MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLU5L2X31e-110U5L2X3_G
STRINGVIT_18s0001g07900.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-83AGAMOUS-like 44